Loading...
Statistics
Advertisement

Art By God - Nature's Art and Earth's Wonders | Nature Product Retail ...
www.artbygodstore.com/
Art By God nature store has a diverse collection of unique nature products, ethnic art, artifacts, fossils, bones, rocks and minerals, furs, hides and ...

Artbygodstore.com

Domain is redirected to: Artbygod.com
Advertisement
Conversion Technology Metas Server
Artbygodstore.com is hosted in United States / San Francisco . Artbygodstore.com doesn't use HTTPS protocol. Number of used technologies: 4. First technologies: CSS, Html, Html5, Number of used javascripts: 8. First javascripts: TemplateArtifacts.js, Jquery.min.js, Stl.js, Number of used analytics tools: 2. First analytics tools: Google Analytics, Quantcast Measurement, Its server type is: Sun-ONE-Web-Server/6.1. Its CMS is: Webly.

Technologies in use by Artbygodstore.com

Technology

Number of occurences: 4
  • CSS
  • Html
  • Html5
  • Javascript

Advertisement

Javascripts

Number of occurences: 8
  • templateArtifacts.js
  • jquery.min.js
  • stl.js
  • main.js
  • commerce-core.js
  • main-commerce-browse.js
  • element.js

Content Management System

Number of occurences: 1
  • Webly

Analytics

Number of occurences: 2
  • Google Analytics
  • Quantcast Measurement

Server Type

  • Sun-ONE-Web-Server/6.1

Google Analytics ID

  • UA-42325060-1

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Founded!
visitors List Founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Not founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Artbygodstore.com

Missing HTTPS protocol.

    Meta - Artbygodstore.com

    Number of occurences: 8
    • Name:
      Content: ll-cc
    • Name: description
      Content: Art By God nature store has a diverse collection of unique nature products, ethnic art, artifacts, fossils, bones, rocks and minerals, furs, hides and taxidermy, cow hides, rugs and pillows, hand crafted jewelry and home decor items.
    • Name: keywords
      Content:
    • Name: robots
      Content: index,follow
    • Name: google-site-verification
      Content: XgTr4Oo3p0QEnN9rZTpCuhkh_3Bu2V4UO1tjIMOx2Zk
    • Name: msvalidate.01
      Content: 76B08E4E22715B2D24E72C60E7FAC0A0
    • Name: Author
      Content: Art By God, Inc.
    • Name: google-translate-customization
      Content: df3d04867c109a6e-8a960a9075f26925-g7bb055bf55a2c788-20

    Server / Hosting

    • IP: 199.34.228.59
    • Latitude: 37.77
    • Longitude: -122.39
    • Country: United States
    • City: San Francisco

    Rname

    • ns39.worldnic.com
    • ns40.worldnic.com
    • p.webcom.ctmail.com

    Target

    • namehost.WORLDNIC.com

    HTTP Header Response

    HTTP/1.1 301 Moved Permanently Server: Sun-ONE-Web-Server/6.1 Date: Sun, 07 Aug 2016 17:03:11 GMT Content-Length: 122 Content-Type: text/html Location: http://www.artbygod.com X-Cache: MISS from s_hh40 X-Cache-Lookup: MISS from s_hh40:80 Via: 1.1 s_hh40 (squid/3.5.11) Connection: keep-alive HTTP/1.1 200 OK Date: Sun, 07 Aug 2016 17:03:11 GMT Server: Apache Set-Cookie: is_mobile=0; path=/; domain=www.artbygod.com Set-Cookie: language=en; expires=Sun, 21-Aug-2016 17:03:11 GMT; Max-Age=1209600; path=/ Cache-Control: private ETag: W/"81ee4f5afc8e54299a158626f7fe7513" Vary: Accept-Encoding,User-Agent X-Host: pages1.sf2p.intern.weebly.net X-UA-Compatible: IE=edge,chrome=1 Content-Type: text/html; charset=UTF-8 X-W-DC: SFO X-Cache: MISS from s_hh40 X-Cache-Lookup: MISS from s_hh40:80 Transfer-Encoding: chunked Via: 1.1 s_hh40 (squid/3.5.11) Connection: keep-alive

    DNS

    host: artbygodstore.com
    1. class: IN
    2. ttl: 7200
    3. type: A
    4. ip: 205.178.189.131
    host: artbygodstore.com
    1. class: IN
    2. ttl: 7200
    3. type: NS
    4. target: ns39.worldnic.com
    host: artbygodstore.com
    1. class: IN
    2. ttl: 7200
    3. type: NS
    4. target: ns40.worldnic.com
    host: artbygodstore.com
    1. class: IN
    2. ttl: 7200
    3. type: SOA
    4. mname: NS39.WORLDNIC.com
    5. rname: namehost.WORLDNIC.com
    6. serial: 115060211
    7. refresh: 10800
    8. retry: 3600
    9. expire: 604800
    10. minimum-ttl: 3600
    host: artbygodstore.com
    1. class: IN
    2. ttl: 3600
    3. type: MX
    4. pri: 10
    5. target: p.webcom.ctmail.com

    Common Typos/Mistakes

    This list shows You some spelling mistakes at internet search for this domain.

    www.rtbygodstore.com, www.aortbygodstore.com, www.ortbygodstore.com, www.aprtbygodstore.com, www.prtbygodstore.com, www.a9rtbygodstore.com, www.9rtbygodstore.com, www.artbygodstore.com, www.rtbygodstore.com, www.airtbygodstore.com, www.irtbygodstore.com, www.aurtbygodstore.com, www.urtbygodstore.com, www.atbygodstore.com, www.aritbygodstore.com, www.aitbygodstore.com, www.arotbygodstore.com, www.aotbygodstore.com, www.arltbygodstore.com, www.altbygodstore.com, www.arltbygodstore.com, www.altbygodstore.com, www.ar.tbygodstore.com, www.a.tbygodstore.com, www.arbygodstore.com, www.artqbygodstore.com, www.arqbygodstore.com, www.artabygodstore.com, www.arabygodstore.com, www.art bygodstore.com, www.ar bygodstore.com, www.artwbygodstore.com, www.arwbygodstore.com, www.artebygodstore.com, www.arebygodstore.com, www.artzbygodstore.com, www.arzbygodstore.com, www.artxbygodstore.com, www.arxbygodstore.com, www.artcbygodstore.com, www.arcbygodstore.com, www.artygodstore.com, www.artbqygodstore.com, www.artqygodstore.com, www.artbwygodstore.com, www.artwygodstore.com, www.artbzygodstore.com, www.artzygodstore.com, www.artbxygodstore.com, www.artxygodstore.com, www.artbygodstore.com, www.artygodstore.com, www.artbsygodstore.com, www.artsygodstore.com, www.artbyygodstore.com, www.artyygodstore.com, www.artbeygodstore.com, www.arteygodstore.com, www.artbdygodstore.com, www.artdygodstore.com, www.artbcygodstore.com, www.artcygodstore.com, www.artbgodstore.com, www.artbyzgodstore.com, www.artbzgodstore.com, www.artbyagodstore.com, www.artbagodstore.com, www.artbysgodstore.com, www.artbsgodstore.com, www.artbydgodstore.com, www.artbdgodstore.com, www.artbygodstore.com, www.artbgodstore.com, www.artbycgodstore.com, www.artbcgodstore.com, www.artby godstore.com, www.artb godstore.com, www.artbyodstore.com, www.artbygsodstore.com, www.artbysodstore.com, www.artbygxodstore.com, www.artbyxodstore.com, www.artbygyodstore.com, www.artbyyodstore.com, www.artbyghodstore.com, www.artbyhodstore.com, www.artbygnodstore.com, www.artbynodstore.com, www.artbygcodstore.com, www.artbycodstore.com, www.artbygdodstore.com, www.artbydodstore.com, www.artbygeodstore.com, www.artbyeodstore.com, www.artbygrodstore.com, www.artbyrodstore.com, www.artbygtodstore.com, www.artbytodstore.com, www.artbygbodstore.com, www.artbybodstore.com, www.artbygvodstore.com, www.artbyvodstore.com, www.artbygdstore.com, www.artbygobdstore.com, www.artbygbdstore.com, www.artbygohdstore.com, www.artbyghdstore.com, www.artbygogdstore.com, www.artbyggdstore.com, www.artbygojdstore.com, www.artbygjdstore.com, www.artbygomdstore.com, www.artbygmdstore.com, www.artbygo dstore.com, www.artbyg dstore.com, www.artbygovdstore.com, www.artbygvdstore.com, www.artbygostore.com, www.artbygodtstore.com, www.artbygotstore.com, www.artbygodgstore.com, www.artbygogstore.com, www.artbygodbstore.com, www.artbygobstore.com, www.artbygodxstore.com, www.artbygoxstore.com, www.artbygodsstore.com, www.artbygosstore.com, www.artbygodfstore.com, www.artbygofstore.com, www.artbygodvstore.com, www.artbygovstore.com, www.artbygodystore.com, www.artbygoystore.com, www.artbygodzstore.com, www.artbygozstore.com, www.artbygodastore.com, www.artbygoastore.com, www.artbygodestore.com, www.artbygoestore.com, www.artbygodrstore.com, www.artbygorstore.com, www.artbygodtore.com, www.artbygodsetore.com, www.artbygodetore.com, www.artbygodswtore.com, www.artbygodwtore.com, www.artbygodsdtore.com, www.artbygoddtore.com, www.artbygodsxtore.com, www.artbygodxtore.com, www.artbygodsftore.com, www.artbygodftore.com, www.artbygodsgtore.com, www.artbygodgtore.com, www.artbygodsttore.com, www.artbygodttore.com, www.artbygodsore.com, www.artbygodstqore.com, www.artbygodsqore.com, www.artbygodstaore.com, www.artbygodsaore.com, www.artbygodst ore.com, www.artbygods ore.com, www.artbygodstwore.com, www.artbygodswore.com, www.artbygodsteore.com, www.artbygodseore.com, www.artbygodstzore.com, www.artbygodszore.com, www.artbygodstxore.com, www.artbygodsxore.com, www.artbygodstcore.com, www.artbygodscore.com,

    Other websites we recently analyzed

    1. www.americainonehour.com
      Houston (United States) - 108.167.135.116
      Server software: Apache-Coyote/1.1
      Technology: CSS
    2. 無効なURLです
      Osaka (Japan) - 183.90.228.56
      Server software: nginx/1.6.2
      Technology: Html
      Number of meta tags: 1
    3. Muse EEK - Bruce ArnoldMuse EEK | Bruce Arnold
      Bruce Arnold
      Scottsdale (United States) - 50.62.99.1
      G Analytics ID: UA-62399355-1
      Server software: Microsoft-IIS/7.5
      Technology: CSS, Font Awesome, Google Font API, Html, Html5, Javascript, jQuery, jQuery Fancybox, JW Player, MediaElement, Php, Pingback, Google Analytics, Wordpress
      Number of Javascript: 40
      Number of meta tags: 5
    4. nancykhawamfamilylawandmediation.net
      United Kingdom - 81.21.76.62
      Server software: Apache/2.2.3 (CentOS)
      Technology: CSS, Html, Javascript, Php
      Number of Javascript: 1
      Number of meta tags: 1
    5. fachkosmetik.info
      Karlsruhe (Germany) - 217.160.122.83
      Server software: Apache
      Technology: Html
      Number of meta tags: 1
    6. buderusboilers.com
      Tampa (United States) - 192.64.147.162
      Server software: Apache
      Technology: AJAX Libraries API, Html, Javascript, Php
      Number of Javascript: 1
      Number of meta tags: 2
    7. Home
      Netherlands - 5.255.68.212
      Server software: Apache/2
      Technology: CSS, Html, Html5, Javascript, Php
      Number of Javascript: 5
      Number of meta tags: 2
    8. SabiTech
      SabiTech, Technology makes life easy.
      London (United Kingdom) - 5.10.105.47
      Server software: Apache
      Technology: Google Adsense, CSS, Google Font API, Html, Javascript, jQuery Cycle, jQuery UI, SuperFish
      Number of Javascript: 16
      Number of meta tags: 4
    9. Консалтинговая компания - Главная
      Russian Federation - 185.26.122.226
      Server software: nginx/1.6.3
      Technology: CSS, Html, Javascript, jQuery Hover Intent, Php, SVG, Yandex.Metrika, Joomla
      Number of Javascript: 15
      Number of meta tags: 2
    10. JJKC
      JJKC
      Brazil - 187.45.240.37
      Server software: Apache
      Technology: CSS, Html, Javascript, MooTools, Php
      Number of Javascript: 3
      Number of meta tags: 5

    Check Other Websites